HORDB

ID: hor004590
Uniprot ID: P63314
Protein name: Thymosin beta-10
Gene name: TMSB10
Organism: Equus caballus (Horse)
Family: Thymosin beta family
Source: Animal
Expression: NA
Disease: NA
Comments: NA
Taxonomy: Equus (genus), Equidae (family), Perissodactyla (order), Laurasiatheria (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
GO MF: GO:0003779 actin binding; GO:0003785 actin monomer binding
GO BP: GO:0007015 actin filament organization; GO:0030334 regulation of cell migration; GO:0042989 sequestering of actin monomers
GO CC: GO:0005737 cytoplasm; GO:0005856 cytoskeleton

Sequence: ADKPDMGEIASFDKAKLKKTETQEKNTLPTKETIEQEKRSEIS
Length: 43(2-44)
Propeptide: MADKPDMGEIASFDKAKLKKTETQEKNTLPTKETIEQEKRSEIS
Signal peptide: NA
Modification: T1 N-acetylalanine;T3 N6-acetyllysine;T11 Phosphoserine;T14 N6-acetyllysine;T20 Phosphothreonine;T22 Phosphothreonine;T33 Phosphothreonine;T38 N6-acetyllysine;T40 Phosphoserine
Glycosylation: NA
Mutagenesis: NA

Function: Plays an important role in the organization of the cytoskeleton.
Mechanism: Binds to and sequesters actin monomers (G actin) and therefore inhibits actin polymerization
Cross BBB: NA
Target: NA
Target Unid: NA
IC50: NA
EC50: NA
ED50: NA
Kd: NA
Half life: NA

Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)

hor004590_AF2.pdb

hor004590_ESM.pdb

Mass:	564380	Formula:	C209H351N57O75S
Absent amino acids:	CHVWY	Common amino acids:	K
pI:	5.02	Basic residues:	9
Polar residues:	10	Hydrophobic residues:	9
Hydrophobicity:	-138.37	Boman Index:	-13762
Half-Life / Aliphatic Index:	4.4 hour	Aliphatic Index:	52.33
Instability Index:	5762.79	Extinction Coefficient cystines:	0
Absorbance 280nm:	0

PubMed ID: NA
Title: Isolation and structural identification of beta-thymosins from equine tissue: development of a specific ELISA against thymosin beta-10 (TBeta-10).