General Information

  • ID:  hor004590
  • Uniprot ID:  P63314
  • Protein name:  Thymosin beta-10
  • Gene name:  TMSB10
  • Organism:  Equus caballus (Horse)
  • Family:  Thymosin beta family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Equus (genus), Equidae (family), Perissodactyla (order), Laurasiatheria (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0003779 actin binding; GO:0003785 actin monomer binding
  • GO BP:  GO:0007015 actin filament organization; GO:0030334 regulation of cell migration; GO:0042989 sequestering of actin monomers
  • GO CC:  GO:0005737 cytoplasm; GO:0005856 cytoskeleton

Sequence Information

  • Sequence:  ADKPDMGEIASFDKAKLKKTETQEKNTLPTKETIEQEKRSEIS
  • Length:  43(2-44)
  • Propeptide:  MADKPDMGEIASFDKAKLKKTETQEKNTLPTKETIEQEKRSEIS
  • Signal peptide:  NA
  • Modification:  T1 N-acetylalanine;T3 N6-acetyllysine;T11 Phosphoserine;T14 N6-acetyllysine;T20 Phosphothreonine;T22 Phosphothreonine;T33 Phosphothreonine;T38 N6-acetyllysine;T40 Phosphoserine
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Plays an important role in the organization of the cytoskeleton.
  • Mechanism:  Binds to and sequesters actin monomers (G actin) and therefore inhibits actin polymerization
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P63314-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor004590_AF2.pdbhor004590_ESM.pdb

Physical Information

Mass: 564380 Formula: C209H351N57O75S
Absent amino acids: CHVWY Common amino acids: K
pI: 5.02 Basic residues: 9
Polar residues: 10 Hydrophobic residues: 9
Hydrophobicity: -138.37 Boman Index: -13762
Half-Life: 4.4 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 52.33
Instability Index: 5762.79 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  NA
  • Title:  Isolation and structural identification of beta-thymosins from equine tissue: development of a specific ELISA against thymosin beta-10 (TBeta-10).